ATP2B4 / PMCA4 Antibody
Product Sizes
100 ul
£ POA
LS-C496817-100UL
20 ul
£ POA
LS-C496817-20UL
About this Product
- SKU:
- LS-C496817
- Additional Names:
- ATP2B4, HPMCA4, PMCA4b, PMCA4x, Sarcolemmal calcium pump, MXRA1, PMCA4
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1141-1205 of human ATP2B4 (NP_001675.3). ELPRTPLLDEEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:510134
