RPA70 / RPA1 Antibody
Product Sizes
100 ug
£ POA
LS-C490557-100UG
About this Product
- SKU:
- LS-C490557
- Additional Names:
- RPA1, HSSB, MST075, Replication factor A protein 1, Replication protein A1 (70kD), RF-A, RF-A protein 1, MSTP075, Replication protein A1, 70kDa, RP-A, REPA1, RP-A p70, RPA70
- Application:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR of human RPA1 were used as the immunogen for the RPA1 antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:503533
