ABCB2 / TAP1 Antibody
Product Sizes
100 ug
£ POA
LS-C490496-100UG
About this Product
- SKU:
- LS-C490496
- Additional Names:
- TAP1, ABC17, ABCB2, APT1, D6S114E, ABC transporter, MHC 1, Ham1, Peptide transporter TAP1, PSF1, TAP1N, MTP1, Peptide transporter PSF1, PSF-1, Peptide supply factor 1, RING4, Y3
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN of human TAP1 were used as the immunogen for the TAP1 antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:503472
