PAK7/PAK5 Antibody
Product Sizes
100 ug
£ POA
LS-C490406-100UG
About this Product
- SKU:
- LS-C490406
- Additional Names:
- PAK7/PAK5, p21(CDKN1A)-activated kinase 7, p21CDKN1A-activated kinase 7, PAK7, PAK-7, PAK5, KIAA1264, p21-activated kinase 5, PAK-5, p21-activated kinase 7, Protein kinase PAK5
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids DPQEQKFTGLPQQWHSLLADTANRPKPMVD of human PAK7/5 were used as the immunogen for the PAK5 antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:503382
