BMP2 Antibody
Product Sizes
100 ug
£ POA
LS-C490360-100UG
About this Product
- SKU:
- LS-C490360
- Additional Names:
- BMP2, BDA2, BMP-2, BMP-2A, BMP2A, Bone morphogenetic protein 2, Bone morphogenetic protein 2A
- Application:
- ELISA, IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids QAKHKQRKRLKSSCKRHPLYVDFSDVGWND of human BMP2 were used as the immunogen for the BMP2 antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:503336
