ARID1A / BAF250 Antibody
Product Sizes
100 ug
£ POA
LS-C490359-100UG
About this Product
- SKU:
- LS-C490359
- Additional Names:
- ARID1A, BAF250, BAF250a, BRG1-associated factor 250a, C1orf4, BRG1-associated factor 250, ELD, HOSA1, Osa homolog 1, OSA1, OSA1 nuclear protein, SMARCF1, MRD14, p270, B120, BM029, Brain protein 120, C10rf4, HELD, SWI-like protein, SWI/SNF complex protein p270
- Application:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR of human ARID1A were used as the immunogen for the ARID1A antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:503335
