HSPA9 / Mortalin / GRP75 Antibody
Product Sizes
100 ug
£ POA
LS-C490316-100UG
About this Product
- SKU:
- LS-C490316
- Additional Names:
- HSPA9, Heat shock 70 kDa protein 9, GRP-75, Heat shock 70kD protein 9B, GRP75, Mortalin-2, Mortalin, perinuclear, Mot-2, MOT2, Peptide-binding protein 74, MOT, MTHSP75, p66-mortalin, PBP74, CSA, HSPA9B, Mortalin
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ of human HSPA9/GRP75 were used as the immunogen for the GRP75 antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:503292
