GJC1 / CX45 / Connexin 45 Antibody
Product Sizes
100 ug
£ POA
LS-C490297-100UG
About this Product
- SKU:
- LS-C490297
- Additional Names:
- GJC1, Connexin-45, Connexin 45, Gap junction alpha-7 protein, Gap junction gamma-1 protein, CX45, Gap junction protein alpha-6, GJA7
- Application:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids ADLEALQREIRMAQERLDLAVQAYSHQNNP H of human Connexin 45/GJA7 were used as the immunogen for the Connexin 45 antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:503273
