IGFBP1 Antibody
Product Sizes
100 ug
£ POA
LS-C490280-100UG
About this Product
- SKU:
- LS-C490280
- Additional Names:
- IGFBP1, AFBP, Amniotic fluid binding protein, Binding protein-26, Binding protein-25, Binding protein-28, IGF-binding protein 1, IGF-BP25, IBP1, HIGFBP-1, PP12, Placental protein 12, IBP-1, IGFBP-1
- Application:
- ELISA, Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids REIADLKKWKEPCQRELYKVLERLAAAQQKA of mouse IGFBP1 were used as the immunogen for the IGFBP1antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:503256
