EPHB1 / EPH Receptor B1 Antibody
Product Sizes
100 ug
£ POA
LS-C490259-100UG
About this Product
- SKU:
- LS-C490259
- Additional Names:
- EPHB1, Cek6, EK6, ELK, Ephrin type-B receptor 1, Hek6, EPHT2, NET, EPH receptor B1, EPH tyrosine kinase 2, EPH-like kinase 6, Soluble EPHB1 variant 1
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE of human Eph receptor B1 were used as the immunogen for the EPHB1 antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:503235
