XRCC6 / Ku70 Antibody
Product Sizes
100 ug
£ POA
LS-C490195-100UG
About this Product
- SKU:
- LS-C490195
- Additional Names:
- XRCC6, 5-dRP lyase Ku70, 70 kDa subunit of Ku antigen, CTCBF, DNA repair protein XRCC6, D22S671, D22S731, G22P1, Ku autoantigen, 70kDa, Ku autoantigen p70 subunit, Thyroid-lupus autoantigen p70, TLAA, CTC75, KU70, ML8, Thyroid-lupus autoantigen
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD of human Ku70 were used as the immunogen for the Ku70 antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:503171
