NQO1 Antibody
Product Sizes
100 ug
£ POA
LS-C490173-100UG
About this Product
- SKU:
- LS-C490173
- Additional Names:
- NQO1, Azoreductase, DHQU, DT-diaphorase, Dioxin-inducible 1, DIA4, Diaphorase-4, NAD(P)H:quinone oxireductase, Phylloquinone reductase, QR1, Menadione reductase, NMOR1, NMORI, DTD, Quinone reductase 1
- Application:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK of human NQO1 were used as the immunogen for the NQO1 antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:503149
