CCL27 Antibody
Product Sizes
100 ul
£ POA
LS-C411380-100UL
20 ul
£ POA
LS-C411380-20UL
About this Product
- SKU:
- LS-C411380
- Additional Names:
- CCL27, ALP, Chemokine alp, C-C motif chemokine 27, CC chemokine ILC, CTAK, ESKINE, IL-11 R-alpha-locus chemokine, ILC, IL-11 Ralpha-locus chemokine, PESKY, SCYA27, Skinkine, CTACK, Il-11r alpha-locus chemokine, Small-inducible cytokine A27
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 25-112 of human CCL27 (NP_006655.1). FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Specificity:
- Human CCL27
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:423745
