BRAK / CXCL14 Antibody
Product Sizes
100 ul
£ POA
LS-C411376-100UL
20 ul
£ POA
LS-C411376-20UL
About this Product
- SKU:
- LS-C411376
- Additional Names:
- CXCL14, BRAK, C-X-C motif chemokine 14, Bolekine, Breast and kidney, Chemokine BRAK, KS1, Mip2 gamma, MIP2G, SCYB14, Small-inducible cytokine B14, MIP-2 gamma, BMAC, Tumor-suppressing chemokine, KEC, MIP-2g, NJAC
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 35-111 of human CXCL14 (NP_004878.2). SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human BRAK / CXCL14
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:423741
