AVPR1A / V1a Receptor Antibody
Product Sizes
100 ul
£ POA
LS-C409934-100UL
20 ul
£ POA
LS-C409934-20UL
About this Product
- SKU:
- LS-C409934
- Additional Names:
- AVPR1A, AVPR V1a, V1a receptor, AVPR1, V1a vasopressin receptor, Vasopressin V1a receptor, V1aR
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 349-418 of human AVPR1A (NP_000697.1). MFFSGHLLQDCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human AVPR1A / V1a Receptor
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:422299
