BLOC1S2 Antibody
Product Sizes
100 ul
£ POA
LS-C409551-100UL
20 ul
£ POA
LS-C409551-20UL
About this Product
- SKU:
- LS-C409551
- Additional Names:
- BLOC1S2, Centrosome protein oncogene, Centrosome-associated protein, CEAP, RP11-316M21.4, BLOC-1 subunit 2, BLOS2, Centrosomal 10 kDa protein
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 44-142 of human BLOC1S2 (NP_776170.2). MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human BLOC1S2
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:421916
