ADCY3 / Adenylate Cyclase 3 Antibody (Cy3)
Product Sizes
100 ul
£ POA
LS-C409419-100UL
20 ul
£ POA
LS-C409419-20UL
About this Product
- SKU:
- LS-C409419
- Additional Names:
- ADCY3, AC-III, AcIII, Adenylyl cyclase 3, AC3, Adenylate cyclase type III, ATP pyrophosphate-lyase 3, Adenylate cyclase 3, Adenylate cyclase type 3, Adenylyl cyclase, type III, KIAA0511
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Conjugate:
- Cyanine 3
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ADCY3 (NP_004027.2). MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPESLENLYQTYFKRQRHETLLV
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human ADCY3 / Adenylate Cyclase 3
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:421784
