CCL8 / MCP2 Antibody
Product Sizes
100 ul
£ POA
LS-C409097-100UL
20 ul
£ POA
LS-C409097-20UL
About this Product
- SKU:
- LS-C409097
- Additional Names:
- CCL8, C-C motif chemokine 8, HC14, MCP2, Monocyte chemotactic protein 2, Scya10, SCYA8, Small-inducible cytokine A8, MCP-2, Chemokine (C-C motif) ligand 8
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 23-99 of human CCL8 (NP_005614.2). AQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human CCL8 / MCP2
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:421462
