AQP10 / Aquaporin 10 Antibody
Product Sizes
100 ul
£ POA
LS-C408589-100UL
20 ul
£ POA
LS-C408589-20UL
About this Product
- SKU:
- LS-C408589
- Additional Names:
- AQP10, Aquaglyceroporin-10, Aquaporin 10, Aquaporin-10, AQP-10, AQPA_HUMAN, Small intestine aquaporin
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 209-301 of human AQP10 (NP_536354.2). CGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human AQP10 / Aquaporin 10
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420954
