LD78 / CCL3L1 Antibody
Product Sizes
100 ul
£ POA
LS-C408571-100UL
20 ul
£ POA
LS-C408571-20UL
About this Product
- SKU:
- LS-C408571
- Additional Names:
- CCL3L1, 464.2, C-C motif chemokine 3-like 1, D17S1718, G0S19-2, LD78, LD78BETA, SCYA3L, SCYA3L1, LD78-beta(1-70), MIP1AP, PAT 464.2
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 24-93 of human CCL3L1 (NP_066286.1). APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human LD78 / CCL3L1
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420936
