S100A7 / Psoriasin Antibody
Product Sizes
100 ul
£ POA
LS-C408380-100UL
20 ul
£ POA
LS-C408380-20UL
About this Product
- SKU:
- LS-C408380
- Additional Names:
- S100A7, PSOR1, Psoriasin, Protein S100-A7, Psoriasin 1, S100A7c
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Concentration:
- 0.14 mg/ml
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human S100A7 (NP_002954.2). MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human S100A7 / Psoriasin.
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420745
