CD3G Antibody
Product Sizes
100 ul
£ POA
LS-C408379-100UL
20 ul
£ POA
LS-C408379-20UL
About this Product
- SKU:
- LS-C408379
- Additional Names:
- CD3G, CD3-GAMMA, CD3g antigen, T-cell receptor gamma chain, T-cell receptors gamma chain, T3G, T-cell receptor T3 gamma chain
- Application:
- Flow Cytometry, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human CD3G (NP_000064.1). QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human CD3G
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420744
