CXCL9 / MIG Antibody
Product Sizes
100 ul
£ POA
LS-C408364-100UL
20 ul
£ POA
LS-C408364-20UL
About this Product
- SKU:
- LS-C408364
- Additional Names:
- CXCL9, Crg-10, Humig, SCYB9, Small-inducible cytokine B9, C-X-C motif chemokine 9, CMK, MIG
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 50 to the C-Terminus of human CXCL9 (NP_002407.1). KQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human CXCL9 / MIG
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420729
