SDF1 / CXCL12 Antibody
Product Sizes
100 ul
£ POA
LS-C408302-100UL
20 ul
£ POA
LS-C408302-20UL
About this Product
- SKU:
- LS-C408302
- Additional Names:
- CXCL12, C-X-C motif chemokine 12, HIRH, IRH, SDF-1, SDF-1b, SDF1A, SDF1B, TPAR1, TLSF-a, TLSF-b, SDF-1a, SDF1, Sdf1alpha, Stromal cell-derived factor 1, TLSF, HSDF-1, PBSF, SCYB12
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 22-89 of human CXCL12 (NP_954637.1). KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human SDF1 / CXCL12
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420667
