TGFBR1 / ALK5 Antibody
Product Sizes
100 ul
£ POA
LS-C408240-100UL
20 ul
£ POA
LS-C408240-20UL
About this Product
- SKU:
- LS-C408240
- Additional Names:
- TGFBR1, AAT5, ACVRLK4, ALK-5, ALK5, Activin receptor-like kinase 5, LDS1A, LDS2A, MSSE, SKR4, TGF beta receptor I, TGF-beta receptor type-1, TGF-beta type I receptor, TbetaR-I, TGFR-1, TGF-beta receptor type I
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 34-124 of human TGFBR1 (NP_001124388.1). LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTGLPLLVQRTI
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human TGFBR1 / ALK5
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420605
