GSTA1 Antibody (aa63-97)
Product Sizes
100 ug
£ POA
LS-C408160-100UG
About this Product
- SKU:
- LS-C408160
- Additional Names:
- GSTA1, Gth1, Glutathione s-transferase a1, Gsta1-1, Glutathione S-transferase 2, GST class-alpha member 1, GST HA subunit 1, GST, class alpha, 1, Gst-epsilon, GST2
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human GSTA1/A2/A3/A4/A5 (63-97 aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE), different from the related mouse and rat sequences by five amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Canine, Guinea Pig, Hamster, Human, Mouse, Other Mammal, Porcine, Rabbit, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Expression not detected.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420524
