SMAD1 Antibody (aa240-270)
Product Sizes
100 ug
£ POA
LS-C408159-100UG
About this Product
- SKU:
- LS-C408159
- Additional Names:
- SMAD1, BSP1, BSP-1, JV4-1, MADH1, Mothers against DPP homolog 1, JV41, SMAD family member 1, TGF-beta signaling protein 1, MADR1, HSMAD1, MAD homolog 1, Mad-related protein 1, SMAD 1
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence in the middle region of human SMAD1 (240-270 aa QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH), different from the related mouse sequence by two amino acids, and from the related rat sequence by five amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Ubiquitous. Highest expression seen in the heart and skeletal muscle.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420523
