SPP1 / Osteopontin Antibody (aa281-314)
Product Sizes
100 ug
£ POA
LS-C408135-100UG
About this Product
- SKU:
- LS-C408135
- Additional Names:
- SPP1, BSPI, BNSP, Bone sialoprotein 1, ETA-1, Nephropontin, OPN, Secreted phosphoprotein 1, SPP-1, SPP1/CALPHA1 fusion, Urinary stone protein, Uropontin, Osteopontin, Bone sialoprotein I
- Application:
- ELISA, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Osteopontin (281-314 aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Bone. Found in plasma.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420499
