ZBTB7A / Pokemon Antibody (aa125-163)
Product Sizes
100 ug
£ POA
LS-C408123-100UG
About this Product
- SKU:
- LS-C408123
- Additional Names:
- ZBTB7A, Factor binding IST protein 1, FBI1, HIV-1 1st-binding protein 1, FBI-1, LRF, Lymphoma related factor, TIP21, TTF-I-interacting peptide 21, Zinc finger protein 857A, ZBTB7, ZNF857A, Pokemon
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of mouse ZBTB7A (125-163 aa DLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino acid.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Widely expressed. In normal thymus, expressed in medullary epithelial cells and Hassle's corpuscles (at protein level). In the spleen, mainly expressed in the white pulp germinal centers (at protein level). Up-regulated in thymic lymphomas. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420487
