ZBTB7A / Pokemon Antibody (aa125-163)
Product Sizes
100 ug
£ POA
LS-C408122-100UG
About this Product
- SKU:
- LS-C408122
- Additional Names:
- ZBTB7A, Factor binding IST protein 1, FBI1, HIV-1 1st-binding protein 1, FBI-1, LRF, Lymphoma related factor, TIP21, TTF-I-interacting peptide 21, Zinc finger protein 857A, ZBTB7, ZNF857A, Pokemon
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human ZBTB7A (125-163 aa DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by ten amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Human, Porcine, Sheep
- Shipping Conditions:
- Ambient
- Specificity:
- Widely expressed. In normal thymus, expressed in medullary epithelial cells and Hassle's corpuscles (at protein level). In tonsil, expressed in squamous epithelium and germinal center lymphocytes (at protein level). Up-regulated in a subset of lymphomas, as well as in a subset of breast, lung, colon, prostate and bladder carcinomas (at protein level). .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420486
