UHRF1 Antibody (aa14-51)
Product Sizes
100 ug
£ POA
LS-C408117-100UG
About this Product
- SKU:
- LS-C408117
- Additional Names:
- UHRF1, HUHRF1, HuNp95, Nuclear protein 95, RING finger protein 106, RNF106, Transcription factor ICBP90, HNP95, ICBP90, Np95
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human UHRF1 (14-51 aa HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Canine, Guinea Pig, Human
- Shipping Conditions:
- Ambient
- Specificity:
- Expressed in thymus, bone marrow, testis, lung and heart. Overexpressed in breast cancer. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420481
