STI1 / STIP1 Antibody (aa505-543)
Product Sizes
100 ug
£ POA
LS-C408108-100UG
About this Product
- SKU:
- LS-C408108
- Additional Names:
- STIP1, HOP, IEF-SSP-3521, NY-REN-11 antigen, p60, STI1, Hsc70/Hsp90-organizing protein, Hsp70/Hsp90-organizing protein, STI1L
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human STIP1 (505-543 aa RLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Amphibian, Bovine, Canine, Guinea Pig, Hamster, Horse, Human, Mouse, Other Mammal, Rabbit, Rat, Sheep
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420472
