BCAR3 Antibody (aa791-825)
Product Sizes
100 ug
£ POA
LS-C408057-100UG
About this Product
- SKU:
- LS-C408057
- Additional Names:
- BCAR3, NSP2, SH2D3B, Novel SH2-containing protein 2
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human BCAR3 (791-825 aa KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL), different from the related mouse sequence by five amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Canine, Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Ubiquitously expressed. Found in several cancer cell lines, but not in nonmalignant breast tissue. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420421
