UCHL1 / PGP9.5 Antibody (aa120-153)
Product Sizes
100 ug
£ POA
LS-C408051-100UG
About this Product
- SKU:
- LS-C408051
- Additional Names:
- UCHL1, Ubiquitin C-terminal hydrolase, PARK5, PGP9.5, PGP95, Ubiquitin thioesterase L1, Neuron cytoplasmic protein 9.5, PGP 9.5, Uch-L1, Ubiquitin carboxyl-terminal esterase L1, HEL-117, NDGOA, HEL-S-53, SPG79
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human PGP9.5 (120-153 aa ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR), different from the related mouse and rat sequences by two amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Guinea Pig, Human, Mouse, Rabbit, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Found in neuronal cell bodies and processes throughout the neocortex (at protein level). Expressed in neurons and cells of the diffuse neuroendocrine system and their tumors. Weakly expressed in ovary. Down-regulated in brains from Parkinson disease and Alzheimer disease patients. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420415
