TGFBR2 Antibody (aa96-128)
Product Sizes
100 ug
£ POA
LS-C408041-100UG
About this Product
- SKU:
- LS-C408041
- Additional Names:
- TGFBR2, AAT3, FAA3, HNPCC6, LDS2B, MFS2, TGF-beta receptor type-2, TGF-beta RII, TGFBRII, TGF-beta type II receptor, TGFbeta-RII, TbetaR-II, TGF beta Receptor II, TGF-beta receptor type II, TGF-beta receptor type IIB, TGFR-2, LDS1B, RIIC, TAAD2
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human TGFBR2 (96-128 aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420405
