ABCB2 / TAP1 Antibody (aa438-471)
Product Sizes
100 ug
£ POA
LS-C408034-100UG
About this Product
- SKU:
- LS-C408034
- Additional Names:
- TAP1, ABC17, ABCB2, APT1, D6S114E, ABC transporter, MHC 1, Ham1, Peptide transporter TAP1, PSF1, TAP1N, MTP1, Peptide transporter PSF1, PSF-1, Peptide supply factor 1, RING4, Y3
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence in the middle region of human TAP1 (438-471 aa RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420398
