RAB18 Antibody (aa156-192)
Product Sizes
100 ug
£ POA
LS-C408003-100UG
About this Product
- SKU:
- LS-C408003
- Additional Names:
- RAB18, RAB18 small GTPase, RAB18LI1, Ras-related protein Rab-18, WARBM3
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Rab18 (156-192 aa DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Hamster, Horse, Human, Mouse, Other Mammal, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Ubiquitous.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420367
