RAB11A Antibody (aa171-211)
Product Sizes
100 ug
£ POA
LS-C408001-100UG
About this Product
- SKU:
- LS-C408001
- Additional Names:
- RAB11A, Rab-11, RAB11, Ras-related protein Rab-11A, YL8
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Rab11A (171-211 aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Canine, Guinea Pig, Hamster, Horse, Human, Mouse, Other Mammal, Porcine, Rabbit, Rat, Sheep
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420365
