PLA2G4A Antibody (aa682-721)
Product Sizes
100 ug
£ POA
LS-C407990-100UG
About this Product
- SKU:
- LS-C407990
- Additional Names:
- PLA2G4A, CPLA2, CPLA2-alpha, Cytosolic phospholipase A2, Lysophospholipase, Phospholipase A2 group IVA, PLA2G4
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human PLA2G4A (682-721 aa NFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQ), different from the related mouse and rat sequences by three amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Expressed in various tissues such as macrophages, platelets, neutrophils, fibroblasts and lung endothelium.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420354
