PDIA3 / ERp57 Antibody (aa471-505)
Product Sizes
100 ug
£ POA
LS-C407984-100UG
About this Product
- SKU:
- LS-C407984
- Additional Names:
- PDIA3, 58 kDa microsomal protein, ER protein 57, ERp60, ERp61, Disulfide isomerase ER-60, Endoplasmic reticulum P58, GRP58, HsT17083, p58, Phospholipase C-alpha, PI-PLC, ER protein 60, ER60, ERp57, GRP57, Protein disulfide-isomerase A3
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ERp57 (471-505 aa RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL), different from the related mouse and rat sequences by two amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Other Mammal
- Shipping Conditions:
- Ambient
- Specificity:
- Detected in the flagellum and head region of spermatozoa (at protein level). .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420348
