PDGFRA / PDGFR Alpha Antibody (aa968-1002)
Product Sizes
100 ug
£ POA
LS-C407983-100UG
About this Product
- SKU:
- LS-C407983
- Additional Names:
- PDGFRA, CD140A, CD140a antigen, PDGFalphaR, PDGFR2, PDGFRalpha, AlphaPDGFR, RHEPDGFRA, PDGF receptor alpha, PDGFR-2, PDGFRA/BCR fusion, APDGFR, Pdgf alpha-receptor, PDGF-R-alpha, PDGFR-alpha
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human PDGFRA (968-1002 aa DFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Canine, Horse, Human, Mouse, Porcine, Rat, Sheep
- Shipping Conditions:
- Ambient
- Specificity:
- Detected in platelets (at protein level). Widely expressed. Detected in brain, fibroblasts, smooth muscle, heart, and embryo. Expressed in primary and metastatic colon tumors and in normal colon tissue. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420347
