OGT / O-GLCNAC Antibody (aa1008-1046)
Product Sizes
100 ug
£ POA
LS-C407979-100UG
About this Product
- SKU:
- LS-C407979
- Additional Names:
- OGT, HRNT1, O-GLCNAC
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human OGT (1008-1046 aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Canine, Guinea Pig, Horse, Human, Mouse, Other Mammal, Porcine, Rabbit, Rat, Sheep
- Shipping Conditions:
- Ambient
- Specificity:
- Highly expressed in pancreas and to a lesser extent in skeletal muscle, heart, brain and placenta. Present in trace amounts in lung and liver. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420343
