MAP2K3 / MEK3 / MKK3 Antibody (aa311-347)
Product Sizes
100 ug
£ POA
LS-C407975-100UG
About this Product
- SKU:
- LS-C407975
- Additional Names:
- MAP2K3, MAPKK 3, MAPKK3, PRKMK3, SAPK kinase 2, SAPKK-2, SAPKK2, SKK2, MAP kinase kinase 3, MEK 3, MEK3, MKK3, MAPK/ERK kinase 3
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human MEK3 (311-347 aa AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS), identical to the related mouse sequence.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Canine, Hamster, Horse, Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Abundant expression is seen in the skeletal muscle. It is also widely expressed in other tissues.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420339
