ADRA1A Antibody (aa335-373)
Product Sizes
100 ug
£ POA
LS-C407964-100UG
About this Product
- SKU:
- LS-C407964
- Additional Names:
- ADRA1A, ADRA1L1, Adrenergic alpha 1c receptor, Alpha 1c adrenoceptor, Alpha-adrenergic receptor 1c, ADRA1C, Adrenoceptor alpha 1A, Alpha-1A adrenoceptor, Alpha-1A adrenoreceptor, Alpha-1A adrenergic receptor, Alpha-1C adrenergic receptor, ALPHA1AAR, Alpha1C-AR
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ADRA1A (335-373 aa KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD), different from the related mouse and rat sequences by four amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Specificity:
- Expressed in heart, brain, liver and prostate, but not in kidney, lung, adrenal, aorta and pituitary. Within the prostate, expressed in the apex, base, periurethral and lateral lobe. Isoform 4 is the most abundant isoform expressed in the prostate with high levels also detected in liver and heart. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420328
