PAK7/PAK5 Antibody (aa26-55)
Product Sizes
100 ug
£ POA
LS-C407945-100UG
About this Product
- SKU:
- LS-C407945
- Additional Names:
- PAK7/PAK5, p21(CDKN1A)-activated kinase 7, p21CDKN1A-activated kinase 7, PAK7, PAK-7, PAK5, KIAA1264, p21-activated kinase 5, PAK-5, p21-activated kinase 7, Protein kinase PAK5
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human PAK5 (26-55 aa DPQEQKFTGLPQQWHSLLADTANRPKPMVD), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Canine, Hamster, Horse, Human, Mouse, Other Mammal, Rabbit, Rat, Sheep
- Shipping Conditions:
- Ambient
- Specificity:
- Predominantly expressed in brain.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420309
