MMP8 Antibody (aa120-157)
Product Sizes
100 ug
£ POA
LS-C407939-100UG
About this Product
- SKU:
- LS-C407939
- Additional Names:
- MMP8, CLG1, HNC, Matrix metalloproteinase-8, MMP-8, Neutrophil collagenase, PMNL collagenase, PMNL-CL
- Application:
- ELISA, IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of mouse MMP-8 (120-157 aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD), different from the related human sequence by eleven amino acids, and from the related rat sequence by nine amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Neutrophils. Expressed in uterus. Low levels in kidney and muscle.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420303
