KCNA3 / Kv1.3 Antibody (aa513-544)
Product Sizes
100 ug
£ POA
LS-C407862-100UG
About this Product
- SKU:
- LS-C407862
- Additional Names:
- KCNA3, HGK5, HPCN3, HUKIII, KV1.3, MK3, HLK3, HUK3, Potassium channel 3, Type n potassium channel, PCN3
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human KCNA3 (513-544 aa EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Hamster, Horse, Human, Mouse, Porcine, Rabbit, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420226
