ITGA2B / CD41 Antibody (aa677-711)
Product Sizes
100 ug
£ POA
LS-C407859-100UG
About this Product
- SKU:
- LS-C407859
- Additional Names:
- ITGA2B, BDPLT2, CD41B, GT, gp2B, Integrin alpha-IIb, ITGAB, GPIIb, HPA3, Platelet-specific antigen BAK, CD41, CD41 antigen, GPalpha IIb, GTA
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ITGA2B (677-711 aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Isoform 1 and isoform 2 were identified in platelets and megakaryocytes, but not in reticulocytes or in Jurkat and U-937 white blood cell line. Isoform 3 is expressed by leukemia, prostate adenocarcinoma and melanoma cells but not by platelets or normal prostate or breast epithelial cells.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420223
