HSPA9 / Mortalin / GRP75 Antibody (aa646-679)
Product Sizes
100 ug
£ POA
LS-C407854-100UG
About this Product
- SKU:
- LS-C407854
- Additional Names:
- HSPA9, Heat shock 70 kDa protein 9, GRP-75, Heat shock 70kD protein 9B, GRP75, Mortalin-2, Mortalin, perinuclear, Mot-2, MOT2, Peptide-binding protein 74, MOT, MTHSP75, p66-mortalin, PBP74, CSA, HSPA9B, Mortalin
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Grp75 (646-679 aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Hamster, Human, Mouse, Rabbit, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420218
