HSPA1A Antibody (aa559-596)
Product Sizes
100 ug
£ POA
LS-C407850-100UG
About this Product
- SKU:
- LS-C407850
- Additional Names:
- HSPA1A, Heat shock 70kDa protein 1A, Heat shock 70 kDa protein 1/2, Heat shock 70kD protein 1A, HSP70-1/HSP70-2, HSPA1, HSP70-1A, Heat shock 70 kd protein 1, Heat shock-induced protein, Iroquois homeobox protein 4, HSP70-1, Hsp70.1, HSP70.1/HSP70.2, HSP70I, HSP72
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Hsp70 (559-596 aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Canine, Horse, Human, Mouse, Porcine, Rat, Sheep
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420214
